PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PH01001605G0350
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Bambusoideae; Arundinarodae; Arundinarieae; Arundinariinae; Phyllostachys
Family GRF
Protein Properties Length: 552aa    MW: 58800.4 Da    PI: 8.3303
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PH01001605G0350genomeICBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.27e-24154198145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCsr+++ ++k+CErH++rgr+rsrk++e 
  PH01001605G0350 154 DPEPGRCRRTDGKKWRCSRDAVVDQKYCERHINRGRHRSRKHVEG 198
                      79****************************************996 PP

2QLQ40.67.7e-15100126127
              QLQ   1 saFTaaQlqlLksQilAyKyLaanqPv 27 
                      ++FT++Q+++L++Q+l+yK+++ n+Pv
  PH01001605G0350 100 GPFTPTQWMELEHQALIYKHIVVNAPV 126
                      59************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5166614.775101141IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.9E-10101126IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.264154198IPR014977WRC domain
PfamPF088793.5E-20155197IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 552 aa     Download sequence    Send to blast
MAPPPHGCFF LGSGSPSGGQ MLSFSSSYSN NAGTVASVIC GVGGWCCIGV WRSGLVASLI  60
QLADWLLAPS PWASCKKTTG LDCGSSDVTS MQGVLARVRG PFTPTQWMEL EHQALIYKHI  120
VVNAPVCKCK CDNRVLDFAV GWGTFQLGYS GSADPEPGRC RRTDGKKWRC SRDAVVDQKY  180
CERHINRGRH RSRKHVEGRS SHATKAMLGI AQPALGVSSG KSSGSQAMAQ QPIKTMATNF  240
TDPSPTQFDS SSPQLKYGFA SCLLSWMGHV KLSTIVTSVF LIRMLLDKGN IFDHAQDSTN  300
QQYLQGMFKN TKGPNPSGET SSQADYAIIS TGSLMNAPRS ENANLNPQRS HSKQAQPNPV  360
HHLFGKEIQP DDIQLSISIP MDNSNLSNNY DKAHIGLGVG SSSNEGNSAR ASWIPVSWET  420
SSGGPLGEFF TNTSNKPDDK NKSCPSPSLI LLADGCTTSP QLHSPTGVLQ MTNFSSVSSS  480
TVSSPGSLCN GLLAASLHAM LHAHRLGREM DVIGATGQVL VDFTVVSSVV SCSSCCLQVG  540
VFGQPTIKDY G*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL9287447e-70AL928744.3 Oryza sativa chromosome 12, . BAC OSJNBa0041B10 of library OSJNBa from chromosome 12 of cultivar Nipponbare of ssp. japonica of Oryza sativa (rice), complete sequence.
GenBankAP0149687e-70AP014968.1 Oryza sativa Japonica Group DNA, chromosome 12, cultivar: Nipponbare, complete sequence.
GenBankCP0126207e-70CP012620.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 12 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015698579.11e-169PREDICTED: growth-regulating factor 7-like
SwissprotQ6AWY21e-152GRF7_ORYSJ; Growth-regulating factor 7
TrEMBLJ3NDG61e-169J3NDG6_ORYBR; Uncharacterized protein
STRINGOB12G20240.11e-169(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42903568
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.12e-44growth-regulating factor 1